MPPE1 antibody (N-Term)

Catalog No. ABIN635730

This anti-MPPE1 antibody is a Rabbit Polyclonal antibody detecting MPPE1 in WB. Suitable for Human and Mouse.

Quick Overview for MPPE1 antibody (N-Term) (ABIN635730)

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPPE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MPPE1 Antibody

Binding Specificity: N-Term

Specificity: MPPE1 antibody was raised against the N terminal of MPPE1

Purification: Affinity purified

Immunogen: MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPPE1 Blocking Peptide, (ABIN5614830), is also available for use as a blocking control in assays to test for specificity of this MPPE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPPE1

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Alternative Name: MPPE1

Background: The specific function of MPPE1 is not yet known.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process