GAL3ST3 antibody (C-Term)

Catalog No. ABIN635734

This Rabbit Polyclonal antibody specifically detects GAL3ST3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GAL3ST3 antibody (C-Term) (ABIN635734)

Target: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAL3ST3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GAL3ST3 Antibody

Binding Specificity: C-Term

Specificity: GAL3 ST3 antibody was raised against the C terminal of GAL3 T3

Purification: Affinity purified

Immunogen: GAL3 ST3 antibody was raised using the C terminal of GAL3 T3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAL3ST3 Blocking Peptide, (ABIN5613706), is also available for use as a blocking control in assays to test for specificity of this GAL3ST3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAL0 T3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAL3ST3

Target: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Alternative Name: GAL3ST3

Background: GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.

Molecular Weight: 49 kDa (MW of target protein)