SLC29A2 antibody

Catalog No. ABIN635738

The Rabbit Polyclonal anti-SLC29A2 antibody has been validated for WB. It is suitable to detect SLC29A2 in samples from Human.

Quick Overview for SLC29A2 antibody (ABIN635738)

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC29A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC29A2 Antibody

Purification: Affinity purified

Immunogen: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC29A2 Blocking Peptide, (ABIN5616234), is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC29A2

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Alternative Name: SLC29A2

Background: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Molecular Weight: 50 kDa (MW of target protein)