-
- Target See all SLC29A2 Antibodies
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC29A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
- Top Product
- Discover our top product SLC29A2 Primary Antibody
-
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) antibody
SLC29A2 Reactivity: Human IHC, IF Host: Rabbit Monoclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (C-Term) antibodySLC29A2 Reactivity: Human, Rat, Cow, Rabbit, Horse, Dog, Guinea Pig, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (AA 1-31) antibodySLC29A2 Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB55890 unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (AA 221-320) antibodySLC29A2 Reactivity: Human, Mouse, Rat WB, IF (cc), IF (p), IHC (p), ELISA, ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (AA 1-456) antibodySLC29A2 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (N-Term) antibodySLC29A2 Reactivity: Human, Rabbit WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (AA 51-100) antibodySLC29A2 Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (3rd Intracellular Loop), (AA 273-288) antibodySLC29A2 Reactivity: Mouse, Rat WB, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (AA 362-411) antibodySLC29A2 Reactivity: Human, Rabbit, Horse, Monkey WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
- Alternative Name
- SLC29A2 (SLC29A2 Products)
- Background
- SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
- Molecular Weight
- 50 kDa (MW of target protein)
-
You are here:
