SLC29A2 antibody
-
- Target See all SLC29A2 Antibodies
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC29A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
- Top Product
- Discover our top product SLC29A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
- Alternative Name
- SLC29A2 (SLC29A2 Products)
- Synonyms
- DER12 antibody, ENT2 antibody, HNP36 antibody, Der12 antibody, Ent2 antibody, Hnp36 antibody, ent2 antibody, der12 antibody, hnp36 antibody, MGC82995 antibody, DKFZp468L038 antibody, zgc:110527 antibody, solute carrier family 29 member 2 antibody, solute carrier family 29 (nucleoside transporters), member 2 antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 antibody, SLC29A2 antibody, Slc29a2 antibody, slc29a2.L antibody, slc29a2 antibody
- Background
- SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
- Molecular Weight
- 50 kDa (MW of target protein)
-