SLC35A5 antibody (N-Term)

Catalog No. ABIN635739

This anti-SLC35A5 antibody is a Rabbit Polyclonal antibody detecting SLC35A5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SLC35A5 antibody (N-Term) (ABIN635739)

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35A5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC35A5 Antibody

Binding Specificity: N-Term

Specificity: SLC35 A5 antibody was raised against the N terminal of SLC35 5

Purification: Affinity purified

Immunogen: SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35A5 Blocking Peptide, (ABIN5616236), is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35A5

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Alternative Name: SLC35A5

Background: SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.

Molecular Weight: 48 kDa (MW of target protein)