SLC39A11 antibody

Catalog No. ABIN635740

This Rabbit Polyclonal antibody specifically detects SLC39A11 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SLC39A11 antibody (ABIN635740)

Target: SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC39A11 Antibody

Purification: Affinity purified

Immunogen: SLC39 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A11 Blocking Peptide, (ABIN938686), is also available for use as a blocking control in assays to test for specificity of this SLC39A11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A11

Target: SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))

Alternative Name: SLC39A11

Background: SLC39A11 belongs to the ZIP transporter family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.

Molecular Weight: 35 kDa (MW of target protein)