B3GALT1 antibody (C-Term)

Catalog No. ABIN635750

The Rabbit Polyclonal anti-B3GALT1 antibody is suitable to detect B3GALT1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for B3GALT1 antibody (C-Term) (ABIN635750)

Target: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GALT1 Antibody

Binding Specificity: C-Term

Specificity: B3 GALT1 antibody was raised against the C terminal of B3 ALT1

Purification: Affinity purified

Immunogen: B3 GALT1 antibody was raised using the C terminal of B3 ALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALT1 Blocking Peptide, (ABIN936125), is also available for use as a blocking control in assays to test for specificity of this B3GALT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALT1

Target: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Alternative Name: B3GALT1

Background: B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon.

Molecular Weight: 38 kDa (MW of target protein)