FLT3LG antibody (N-Term)

Catalog No. ABIN635754

This anti-FLT3LG antibody is a Rabbit Polyclonal antibody detecting FLT3LG in WB. Suitable for Human.

Quick Overview for FLT3LG antibody (N-Term) (ABIN635754)

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FLT3LG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FLT3LG Antibody

Binding Specificity: N-Term

Specificity: Flt3 Ligand antibody was raised against the N terminal of FLT3 LG

Purification: Affinity purified

Immunogen: Flt3 Ligand antibody was raised using the N terminal of FLT3 LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Flt3 Ligand Blocking Peptide, (ABIN5613619), is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLT0 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FLT3LG

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Alternative Name: Flt3 Ligand

Background: FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: RTK Signaling