XYLT2 antibody (C-Term)

Catalog No. ABIN635768

The Rabbit Polyclonal anti-XYLT2 antibody has been validated for WB. It is suitable to detect XYLT2 in samples from Mouse, Human, Dog and Rat.

Quick Overview for XYLT2 antibody (C-Term) (ABIN635768)

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XYLT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XYLT2 Antibody

Binding Specificity: C-Term

Specificity: XYLT2 antibody was raised against the C terminal of XYLT2

Purification: Affinity purified

Immunogen: XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XYLT2 Blocking Peptide, (ABIN5617051), is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Alternative Name: XYLT2

Background: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process