HAVCR1 antibody (N-Term)

Catalog No. ABIN635773

Product Details anti-HAVCR1 Antibody

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Binding Specificity: N-Term

Reactivity: Hepatitis A Virus (HAV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAVCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAVCR1 antibody was raised against the N terminal of HAVCR1

Purification: Affinity purified

Immunogen: HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAVCR1 Blocking Peptide, catalog no. 33R-1716, is also available for use as a blocking control in assays to test for specificity of this HAVCR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAVCR1

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Alternative Name: HAVCR1 (HAVCR1 Products)

Synonyms: HAVCR antibody, HAVCR-1 antibody, KIM-1 antibody, KIM1 antibody, TIM antibody, TIM-1 antibody, TIM1 antibody, TIMD-1 antibody, TIMD1 antibody, Kim1 antibody, HAVCR1 antibody, LOC100226241 antibody, AI503787 antibody, Tim1 antibody, Timd1 antibody, hepatitis A virus cellular receptor 1 antibody, hepatitis A virus cellular receptor 1 homolog antibody, HAVCR1 antibody, Havcr1 antibody, LOC100226241 antibody

Target Type: Virus

Background: HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.

Molecular Weight: 39 kDa (MW of target protein)