SLC27A4 antibody

Catalog No. ABIN635777

The Rabbit Polyclonal anti-SLC27A4 antibody has been validated for WB. It is suitable to detect SLC27A4 in samples from Human.

Quick Overview for SLC27A4 antibody (ABIN635777)

Target: SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC27A4 Antibody

Purification: Affinity purified

Immunogen: SLC27 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A4 Blocking Peptide, (ABIN936114), is also available for use as a blocking control in assays to test for specificity of this SLC27A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A4

Target: SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))

Alternative Name: SLC27A4

Background: SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process