SLC27A4 antibody
-
- Target See all SLC27A4 Antibodies
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC27A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC27 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
- Top Product
- Discover our top product SLC27A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC27A4 Blocking Peptide, catalog no. 33R-10148, is also available for use as a blocking control in assays to test for specificity of this SLC27A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
- Alternative Name
- SLC27A4 (SLC27A4 Products)
- Background
- SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-