LCAT antibody (C-Term)
-
- Target See all LCAT Antibodies
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LCAT antibody was raised against the C terminal of LCAT
- Purification
- Affinity purified
- Immunogen
- LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
- Top Product
- Discover our top product LCAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LCAT Blocking Peptide, catalog no. 33R-3643, is also available for use as a blocking control in assays to test for specificity of this LCAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Alternative Name
- LCAT (LCAT Products)
- Synonyms
- AI046659 antibody, D8Wsu61e antibody, MGC82035 antibody, lcat antibody, MGC88964 antibody, LCAT antibody, lecithin-cholesterol acyltransferase antibody, lecithin cholesterol acyltransferase antibody, lecithin-cholesterol acyltransferase L homeolog antibody, solute carrier family 12 member 4 antibody, fragile site, aphidicolin type, common, fra(13)(q13.2) antibody, LCAT antibody, Lcat antibody, lcat.L antibody, lcat antibody, SLC12A4 antibody, FRA13A antibody
- Background
- LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-