ChT antibody

Catalog No. ABIN635784

The Rabbit Polyclonal anti-ChT antibody (ABIN635784) specifically detects ChT in WB. The antibody is reactive with Mouse, Human and Rat samples.

Quick Overview for ChT antibody (ABIN635784)

Target: ChT (High Affinity Choline Transporter (ChT))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ChT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ChT Antibody

Purification: Affinity purified

Immunogen: SLC5 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC5A7 Blocking Peptide, (ABIN937270), is also available for use as a blocking control in assays to test for specificity of this SLC5A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ChT

Target: ChT (High Affinity Choline Transporter (ChT))

Alternative Name: SLC5A7

Background: Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.

Molecular Weight: 63 kDa (MW of target protein)