IGSF9 antibody (N-Term)

Catalog No. ABIN635786

The Rabbit Polyclonal anti-IGSF9 antibody has been validated for WB. It is suitable to detect IGSF9 in samples from Human.

Quick Overview for IGSF9 antibody (N-Term) (ABIN635786)

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGSF9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IGSF9 Antibody

Binding Specificity: N-Term

Specificity: IGSF9 antibody was raised against the N terminal of IGSF9

Purification: Affinity purified

Immunogen: IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGSF9 Blocking Peptide, (ABIN5614164), is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGSF9

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Alternative Name: IGSF9

Background: IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

Molecular Weight: 125 kDa (MW of target protein)