TMEM48 antibody (Middle Region)

Catalog No. ABIN635788

This Rabbit Polyclonal antibody specifically detects TMEM48 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM48 antibody (Middle Region) (ABIN635788)

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM48 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM48 Antibody

Binding Specificity: Middle Region

Specificity: TMEM48 antibody was raised against the middle region of TMEM48

Purification: Affinity purified

Immunogen: TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM48 Blocking Peptide, (ABIN5616681), is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM48

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Alternative Name: TMEM48

Background: TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

Molecular Weight: 76 kDa (MW of target protein)