TBL2 antibody

Catalog No. ABIN635791

Product Details anti-TBL2 Antibody

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBL2 Blocking Peptide, catalog no. 33R-8181, is also available for use as a blocking control in assays to test for specificity of this TBL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBL2

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Alternative Name: TBL2 (TBL2 Products)

Synonyms: wu:fa96f08 antibody, tbl2 antibody, MGC53692 antibody, TBL2 antibody, MGC79804 antibody, MGC140759 antibody, DKFZp469O1728 antibody, WBSCR13 antibody, WS-betaTRP antibody, C76179 antibody, WS-bTRP antibody, transducin (beta)-like 2 antibody, transducin (beta)-like 2 L homeolog antibody, transducin beta like 2 antibody, tbl2 antibody, tbl2.L antibody, TBL2 antibody, Tbl2 antibody

Background: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Molecular Weight: 49 kDa (MW of target protein)