B3GALT6 antibody (C-Term)

Catalog No. ABIN635815

This Rabbit Polyclonal antibody specifically detects B3GALT6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for B3GALT6 antibody (C-Term) (ABIN635815)

Target: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALT6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GALT6 Antibody

Binding Specificity: C-Term

Specificity: B3 GALT6 antibody was raised against the C terminal of B3 ALT6

Purification: Affinity purified

Immunogen: B3 GALT6 antibody was raised using the C terminal of B3 ALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALT6 Blocking Peptide, (ABIN5612257), is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALT6

Target: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Alternative Name: B3GALT6

Background: B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process