Tspan-8 antibody (Middle Region)

Catalog No. ABIN635820

Product Details anti-Tspan-8 Antibody

Target: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tspan-8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 8 antibody was raised against the middle region of TSPAN8

Purification: Affinity purified

Immunogen: Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 8 Blocking Peptide, catalog no. 33R-9530, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tspan-8

Target: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Alternative Name: Tetraspanin 8 (TSPAN8 Products)

Synonyms: tm4sf3 antibody, MGC64550 antibody, GB13255 antibody, TM4SF3 antibody, tetraspanin-8 antibody, tspan8 antibody, TSPAN8 antibody, CO-029 antibody, C76990 antibody, E330007O21Rik antibody, Tm4sf3 antibody, CO-29 antibody, TSPAN-8 antibody, tetraspanin 8 L homeolog antibody, tetraspanin-1 antibody, tetraspanin 8 antibody, tspan8.L antibody, LOC409511 antibody, TSPAN8 antibody, tspan8 antibody, Tspan8 antibody

Background: TSPAN8 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN8 is a cell surface glycoprotein that is known to complex with integrins. TSPAN8 is expressed in different carcinomas.

Molecular Weight: 26 kDa (MW of target protein)