IGF-like family receptor 1 (IGFLR1) (N-Term) antibody

Catalog No. ABIN635834

The Rabbit Polyclonal anti-IGF-like family receptor 1 antibody is suitable to detect IGF-like family receptor 1 in samples from Human. It has been validated for WB.

Quick Overview for IGF-like family receptor 1 (IGFLR1) (N-Term) antibody (ABIN635834)

Target: IGF-like family receptor 1 (IGFLR1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: TMEM149 antibody was raised against the N terminal of TMEM149

Purification: Affinity purified

Immunogen: TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM149 Blocking Peptide, (ABIN5616668), is also available for use as a blocking control in assays to test for specificity of this TMEM149 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM149 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: IGF-like family receptor 1 (IGFLR1)

Alternative Name: TMEM149

Background: TMEM149 is a single-pass type I membrane protein. The exact function of TMEM149 remains unknown.

Molecular Weight: 38 kDa (MW of target protein)