NDST4 antibody

Catalog No. ABIN635843

The Rabbit Polyclonal anti-NDST4 antibody has been validated for WB. It is suitable to detect NDST4 in samples from Human and Mouse.

Quick Overview for NDST4 antibody (ABIN635843)

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDST4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDST4 Antibody

Purification: Affinity purified

Immunogen: NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDST4 Blocking Peptide, (ABIN936135), is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDST4

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Alternative Name: NDST4

Background: NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate.

Molecular Weight: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process