SLC22A15 antibody (Middle Region)

Catalog No. ABIN635853

This anti-SLC22A15 antibody is a Rabbit Polyclonal antibody detecting SLC22A15 in WB. Suitable for Human.

Quick Overview for SLC22A15 antibody (Middle Region) (ABIN635853)

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC22A15 Antibody

Binding Specificity: Middle Region

Specificity: SLC22 A15 antibody was raised against the middle region of SLC22 15

Purification: Affinity purified

Immunogen: SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A15 Blocking Peptide, (ABIN5616197), is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A15

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Alternative Name: SLC22A15

Background: Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.

Molecular Weight: 59 kDa (MW of target protein)