DLK1 antibody

Catalog No. ABIN635854

This Rabbit Polyclonal antibody specifically detects DLK1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DLK1 antibody (ABIN635854)

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLK1 Antibody

Purification: Affinity purified

Immunogen: DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLK1 Blocking Peptide, (ABIN5613217), is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLK1

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Alternative Name: DLK1

Background: DLK1 may have a role in neuroendocrine differentiation.

Molecular Weight: 41 kDa (MW of target protein)