ACPT antibody (Middle Region)

Catalog No. ABIN635869

Product Details anti-ACPT Antibody

Target: ACPT (Acid Phosphatase, Testicular (ACPT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACPT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACPT antibody was raised against the middle region of ACPT

Purification: Affinity purified

Immunogen: ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACPT

Target: ACPT (Acid Phosphatase, Testicular (ACPT))

Alternative Name: ACPT (ACPT Products)

Synonyms: EG546967 antibody, Gm1432 antibody, acid phosphatase 4 antibody, ACP4 antibody, Acp4 antibody

Background: Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.

Molecular Weight: 43 kDa (MW of target protein)