RNF133 antibody (N-Term)

Catalog No. ABIN635910

This anti-RNF133 antibody is a Rabbit Polyclonal antibody detecting RNF133 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RNF133 antibody (N-Term) (ABIN635910)

Target: RNF133 (Ring Finger Protein 133 (RNF133))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF133 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RNF133 Antibody

Binding Specificity: N-Term

Specificity: RNF133 antibody was raised against the N terminal of RNF133

Purification: Affinity purified

Immunogen: RNF133 antibody was raised using the N terminal of RNF133 corresponding to a region with amino acids VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF133 Blocking Peptide, (ABIN5615887), is also available for use as a blocking control in assays to test for specificity of this RNF133 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF133 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF133

Target: RNF133 (Ring Finger Protein 133 (RNF133))

Alternative Name: RNF133

Background: RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molecular Weight: 42 kDa (MW of target protein)