MTTP antibody (N-Term)

Catalog No. ABIN635912

The Rabbit Polyclonal anti-MTTP antibody has been validated for WB. It is suitable to detect MTTP in samples from Human, Mouse and Rat.

Quick Overview for MTTP antibody (N-Term) (ABIN635912)

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTTP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTTP Antibody

Binding Specificity: N-Term

Specificity: MTTP antibody was raised against the N terminal of MTTP

Purification: Affinity purified

Immunogen: MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTTP Blocking Peptide, (ABIN5614877), is also available for use as a blocking control in assays to test for specificity of this MTTP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTTP

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Alternative Name: MTTP

Background: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis