DNAJB11 antibody

Catalog No. ABIN635926

This Rabbit Polyclonal antibody specifically detects DNAJB11 in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for DNAJB11 antibody (ABIN635926)

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJB11 Antibody

Purification: Affinity purified

Immunogen: DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB11 Blocking Peptide, (ABIN938254), is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB11

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Alternative Name: DNAJB11

Background: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling