Receptor Accessory Protein 4 antibody (N-Term)

Catalog No. ABIN635929

This Rabbit Polyclonal antibody specifically detects Receptor Accessory Protein 4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Receptor Accessory Protein 4 antibody (N-Term) (ABIN635929)

Target: Receptor Accessory Protein 4 (REEP4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Receptor Accessory Protein 4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Receptor Accessory Protein 4 Antibody

Binding Specificity: N-Term

Specificity: REEP4 antibody was raised against the N terminal of REEP4

Purification: Affinity purified

Immunogen: REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REEP4 Blocking Peptide, (ABIN937862), is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Receptor Accessory Protein 4

Target: Receptor Accessory Protein 4 (REEP4)

Alternative Name: REEP4

Background: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Molecular Weight: 29 kDa (MW of target protein)