SLC22A13 antibody (N-Term)

Catalog No. ABIN635939

The Rabbit Polyclonal anti-SLC22A13 antibody has been validated for WB. It is suitable to detect SLC22A13 in samples from Human, Mouse and Rat.

Quick Overview for SLC22A13 antibody (N-Term) (ABIN635939)

Target: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC22A13 Antibody

Binding Specificity: N-Term

Specificity: SLC22 A13 antibody was raised against the N terminal of SLC22 13

Purification: Affinity purified

Immunogen: SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A13 Blocking Peptide, (ABIN938270), is also available for use as a blocking control in assays to test for specificity of this SLC22A13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A13

Target: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Alternative Name: SLC22A13

Background: SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.

Molecular Weight: 61 kDa (MW of target protein)