SLC22A13 antibody (N-Term)
-
- Target See all SLC22A13 Antibodies
- SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC22 A13 antibody was raised against the N terminal of SLC22 13
- Purification
- Affinity purified
- Immunogen
- SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM
- Top Product
- Discover our top product SLC22A13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A13 Blocking Peptide, catalog no. 33R-2884, is also available for use as a blocking control in assays to test for specificity of this SLC22A13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))
- Alternative Name
- SLC22A13 (SLC22A13 Products)
- Background
- SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.
- Molecular Weight
- 61 kDa (MW of target protein)
-