PI3 antibody

Catalog No. ABIN635953

Product Details anti-PI3 Antibody

Target: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PI3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PI3 Blocking Peptide, catalog no. 33R-7825, is also available for use as a blocking control in assays to test for specificity of this PI3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PI3

Target: PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))

Alternative Name: PI3 (PI3 Products)

Synonyms: ESI antibody, SKALP antibody, WAP3 antibody, WFDC14 antibody, cementoin antibody, trappin-2 antibody, TRAPPIN-2 antibody, elafin antibody, peptidase inhibitor 3 antibody, peptidase inhibitor 3, skin-derived (SKALP) antibody, PI3 antibody

Background: PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.

Molecular Weight: 6 kDa (MW of target protein)