TMEM187 antibody (Middle Region)

Catalog No. ABIN635956

This Rabbit Polyclonal antibody specifically detects TMEM187 in WB. It exhibits reactivity toward Human.

Quick Overview for TMEM187 antibody (Middle Region) (ABIN635956)

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM187 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM187 Antibody

Binding Specificity: Middle Region

Specificity: TMEM187 antibody was raised against the middle region of TMEM187

Purification: Affinity purified

Immunogen: TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM187 Blocking Peptide, (ABIN937686), is also available for use as a blocking control in assays to test for specificity of this TMEM187 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM187 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM187

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Alternative Name: TMEM187

Background: TMEM187 is a multi-pass membrane protein. The exact function of TMEM187 remains unknown.

Molecular Weight: 29 kDa (MW of target protein)