ERLIN1 antibody (N-Term)

Catalog No. ABIN635966

The Rabbit Polyclonal anti-ERLIN1 antibody has been validated for WB. It is suitable to detect ERLIN1 in samples from Human, Mouse and Rat.

Quick Overview for ERLIN1 antibody (N-Term) (ABIN635966)

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERLIN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERLIN1 Antibody

Binding Specificity: N-Term

Specificity: ERLIN1 antibody was raised against the N terminal of ERLIN1

Purification: Affinity purified

Immunogen: ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERLIN1 Blocking Peptide, (ABIN939963), is also available for use as a blocking control in assays to test for specificity of this ERLIN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERLIN1

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Alternative Name: ERLIN1

Background: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.

Molecular Weight: 39 kDa (MW of target protein)