Nurim antibody

Catalog No. ABIN635972

The Rabbit Polyclonal anti-Nurim antibody has been validated for WB. It is suitable to detect Nurim in samples from Human, Mouse and Rat.

Quick Overview for Nurim antibody (ABIN635972)

Target: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nurim antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nurim Antibody

Purification: Affinity purified

Immunogen: Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nurim Blocking Peptide, (ABIN5615089), is also available for use as a blocking control in assays to test for specificity of this Nurim antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nurim

Target: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Alternative Name: Nurim

Background: The function of Nurim protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 29 kDa (MW of target protein)