QPCTL antibody (Middle Region)

Catalog No. ABIN635992

This Rabbit Polyclonal antibody specifically detects QPCTL in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for QPCTL antibody (Middle Region) (ABIN635992)

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QPCTL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-QPCTL Antibody

Binding Specificity: Middle Region

Specificity: QPCTL antibody was raised against the middle region of QPCTL

Purification: Affinity purified

Immunogen: QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QPCTL Blocking Peptide, (ABIN5615694), is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QPCTL

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Alternative Name: QPCTL

Background: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

Molecular Weight: 43 kDa (MW of target protein)