TMCO3 antibody (N-Term)

Catalog No. ABIN635995

This Rabbit Polyclonal antibody specifically detects TMCO3 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for TMCO3 antibody (N-Term) (ABIN635995)

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCO3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMCO3 Antibody

Binding Specificity: N-Term

Specificity: TMCO3 antibody was raised against the N terminal of TMCO3

Purification: Affinity purified

Immunogen: TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCO3 Blocking Peptide, (ABIN940058), is also available for use as a blocking control in assays to test for specificity of this TMCO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCO3

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Alternative Name: TMCO3

Background: TMCO3 belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter family. It is a multi-pass membrane protein. TMCO3 is a probable Na(+)/H(+) antiporter.

Molecular Weight: 75 kDa (MW of target protein)

Pathways: Proton Transport