Emc7 antibody (Middle Region)

Catalog No. ABIN636001

This Rabbit Polyclonal antibody specifically detects Emc7 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Emc7 antibody (Middle Region) (ABIN636001)

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Emc7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Emc7 Antibody

Binding Specificity: Middle Region

Specificity: C15 ORF24 antibody was raised against the middle region of C15 rf24

Purification: Affinity purified

Immunogen: C15 ORF24 antibody was raised using the middle region of C15 rf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C15ORF24 Blocking Peptide, (ABIN5612416), is also available for use as a blocking control in assays to test for specificity of this C15ORF24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Emc7

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Alternative Name: C15ORF24

Background: The function of C15orf24 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 26 kDa (MW of target protein)