SCUBE2 antibody (C-Term)

Catalog No. ABIN636003

This anti-SCUBE2 antibody is a Rabbit Polyclonal antibody detecting SCUBE2 in WB. Suitable for Human.

Quick Overview for SCUBE2 antibody (C-Term) (ABIN636003)

Target: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCUBE2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SCUBE2 Antibody

Binding Specificity: C-Term

Specificity: SCUBE2 antibody was raised against the C terminal of SCUBE2

Purification: Affinity purified

Immunogen: SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCUBE2 Blocking Peptide, (ABIN940072), is also available for use as a blocking control in assays to test for specificity of this SCUBE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCUBE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCUBE2

Target: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Alternative Name: SCUBE2

Background: SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.

Molecular Weight: 110 kDa (MW of target protein)