UGT2B4 antibody (N-Term)

Catalog No. ABIN636004

This Rabbit Polyclonal antibody specifically detects UGT2B4 in WB. It exhibits reactivity toward Human.

Quick Overview for UGT2B4 antibody (N-Term) (ABIN636004)

Target: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT2B4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT2B4 Antibody

Binding Specificity: N-Term

Specificity: UGT2 B4 antibody was raised against the N terminal of µgT2 4

Purification: Affinity purified

Immunogen: UGT2 B4 antibody was raised using the N terminal of µgT2 4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT2B4 Blocking Peptide, (ABIN5616903), is also available for use as a blocking control in assays to test for specificity of this µgT2B4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT2B4

Target: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Alternative Name: UGT2B4

Background: UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis