UGT2B4 antibody (N-Term)
-
- Target See all UGT2B4 Antibodies
- UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UGT2B4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UGT2 B4 antibody was raised against the N terminal of µgT2 4
- Purification
- Affinity purified
- Immunogen
- UGT2 B4 antibody was raised using the N terminal of µgT2 4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE
- Top Product
- Discover our top product UGT2B4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UGT2B4 Blocking Peptide, catalog no. 33R-6722, is also available for use as a blocking control in assays to test for specificity of this µgT2B4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))
- Alternative Name
- UGT2B4 (UGT2B4 Products)
- Synonyms
- HLUG25 antibody, UDPGTH1 antibody, UGT2B11 antibody, UDPGT2B4 antibody, UGT2B17 antibody, UGT2B28 antibody, UDP glucuronosyltransferase family 2 member B4 antibody, UDP-glucuronosyltransferase 2B4 antibody, UGT2B4 antibody, LOC615303 antibody, LOC100066359 antibody
- Background
- UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-