B3GNT7 antibody (N-Term)

Catalog No. ABIN636032

The Rabbit Polyclonal anti-B3GNT7 antibody has been validated for WB. It is suitable to detect B3GNT7 in samples from Human.

Quick Overview for B3GNT7 antibody (N-Term) (ABIN636032)

Target: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GNT7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GNT7 Antibody

Binding Specificity: N-Term

Specificity: B3 GNT7 antibody was raised against the N terminal of B3 NT7

Purification: Affinity purified

Immunogen: B3 GNT7 antibody was raised using the N terminal of B3 NT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GNT7 Blocking Peptide, (ABIN5612261), is also available for use as a blocking control in assays to test for specificity of this B3GNT7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GNT7

Target: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Alternative Name: B3GNT7

Background: B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process