HS6ST3 antibody (C-Term)

Catalog No. ABIN636033

This anti-HS6ST3 antibody is a Rabbit Polyclonal antibody detecting HS6ST3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for HS6ST3 antibody (C-Term) (ABIN636033)

Target: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HS6ST3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HS6ST3 Antibody

Binding Specificity: C-Term

Specificity: HS6 ST3 antibody was raised against the C terminal of HS6 T3

Purification: Affinity purified

Immunogen: HS6 ST3 antibody was raised using the C terminal of HS6 T3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS6ST3 Blocking Peptide, (ABIN5614072), is also available for use as a blocking control in assays to test for specificity of this HS6ST3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HS6ST3

Target: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Alternative Name: HS6ST3

Background: Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.

Molecular Weight: 55 kDa (MW of target protein)