Prolipoprotein Diacylglyceryl Transferase antibody (C-Term)
-
- Target
- Prolipoprotein Diacylglyceryl Transferase (IGT)
- Binding Specificity
- C-Term
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- PIGT antibody was raised against the C terminal of PIGT
- Purification
- Affinity purified
- Immunogen
- PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIGT Blocking Peptide, catalog no. 33R-5256, is also available for use as a blocking control in assays to test for specificity of this PIGT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Prolipoprotein Diacylglyceryl Transferase (IGT)
- Alternative Name
- IGT
- Background
- PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.
- Molecular Weight
- 64 kDa (MW of target protein)
-