Receptor Accessory Protein 1 antibody (C-Term)

Catalog No. ABIN636040

This Rabbit Polyclonal antibody specifically detects Receptor Accessory Protein 1 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for Receptor Accessory Protein 1 antibody (C-Term) (ABIN636040)

Target: Receptor Accessory Protein 1 (REEP1)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Receptor Accessory Protein 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Receptor Accessory Protein 1 Antibody

Binding Specificity: C-Term

Specificity: REEP1 antibody was raised against the C terminal of REEP1

Purification: Affinity purified

Immunogen: REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REEP1 Blocking Peptide, (ABIN938090), is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Receptor Accessory Protein 1

Target: Receptor Accessory Protein 1 (REEP1)

Alternative Name: REEP1

Background: REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Molecular Weight: 22 kDa (MW of target protein)