Layilin antibody (N-Term)

Catalog No. ABIN636057

This anti-Layilin antibody is a Rabbit Polyclonal antibody detecting Layilin in WB. Suitable for Human.

Quick Overview for Layilin antibody (N-Term) (ABIN636057)

Target: Layilin (LAYN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Layilin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Layilin Antibody

Binding Specificity: N-Term

Specificity: LAYN antibody was raised against the N terminal of LAYN

Purification: Affinity purified

Immunogen: LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAYN Blocking Peptide, (ABIN937219), is also available for use as a blocking control in assays to test for specificity of this LAYN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Layilin

Target: Layilin (LAYN)

Alternative Name: LAYN

Background: LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.

Molecular Weight: 42 kDa (MW of target protein)