DAGLB antibody (Middle Region)

Catalog No. ABIN636059

The Rabbit Polyclonal anti-DAGLB antibody has been validated for WB. It is suitable to detect DAGLB in samples from Human, Mouse and Rat.

Quick Overview for DAGLB antibody (Middle Region) (ABIN636059)

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAGLB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DAGLB Antibody

Binding Specificity: Middle Region

Specificity: DAGLB antibody was raised against the middle region of DAGLB

Purification: Affinity purified

Immunogen: DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAGLB Blocking Peptide, (ABIN5613116), is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAGLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAGLB

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Alternative Name: DAGLB

Background: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Molecular Weight: 74 kDa (MW of target protein)