SLC27A5 antibody
-
- Target See all SLC27A5 Antibodies
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC27A5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC27 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
- Top Product
- Discover our top product SLC27A5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC27A5 Blocking Peptide, catalog no. 33R-4549, is also available for use as a blocking control in assays to test for specificity of this SLC27A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
- Alternative Name
- SLC27A5 (SLC27A5 Products)
- Background
- The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons.
- Molecular Weight
- 75 kDa (MW of target protein)
-