CYP2A7 antibody (N-Term)

Catalog No. ABIN636074

The Rabbit Polyclonal anti-CYP2A7 antibody is suitable to detect CYP2A7 in samples from Human. It has been validated for WB.

Quick Overview for CYP2A7 antibody (N-Term) (ABIN636074)

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2A7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CYP2A7 Antibody

Binding Specificity: N-Term

Specificity: CYP2 A7 antibody was raised against the N terminal of CYP2 7

Purification: Affinity purified

Immunogen: CYP2 A7 antibody was raised using the N terminal of CYP2 7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2A7 Blocking Peptide, (ABIN5613075), is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2A7

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Alternative Name: CYP2A7

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum, its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

Molecular Weight: 56 kDa (MW of target protein)