SLC22A6 antibody

Catalog No. ABIN636097

Product Details anti-SLC22A6 Antibody

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A6 Blocking Peptide, catalog no. 33R-1168, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A6

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Alternative Name: SLC22A6 (SLC22A6 Products)

Background: SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport