SLC22A6 antibody
-
- Target See all SLC22A6 Antibodies
- SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP
- Top Product
- Discover our top product SLC22A6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A6 Blocking Peptide, catalog no. 33R-1168, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))
- Alternative Name
- SLC22A6 (SLC22A6 Products)
- Synonyms
- HOAT1 antibody, OAT1 antibody, PAHT antibody, ROAT1 antibody, NKT antibody, Oat1 antibody, Orctl1 antibody, mOat1 antibody, slc22a6 antibody, zgc:77073 antibody, SLC22A6 antibody, Paht antibody, Roat1 antibody, nkt antibody, oat1 antibody, oat1-B antibody, paht antibody, roat1 antibody, slc22a6-B antibody, Slc22a6 antibody, solute carrier family 22 member 6 antibody, solute carrier family 22 (organic anion transporter), member 6 antibody, solute carrier family 22 (organic anion transporter), member 6, like antibody, Solute carrier family 22 member 6 antibody, solute carrier family 22 (organic anion transporter), member 6 S homeolog antibody, SLC22A6 antibody, Slc22a6 antibody, slc22a6l antibody, s22a6 antibody, slc22a6.S antibody
- Background
- SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-