NKAIN4 antibody (N-Term)

Catalog No. ABIN636103

This Rabbit Polyclonal antibody specifically detects NKAIN4 in WB. It exhibits reactivity toward Human.

Quick Overview for NKAIN4 antibody (N-Term) (ABIN636103)

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKAIN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NKAIN4 Antibody

Binding Specificity: N-Term

Specificity: NKAIN4 antibody was raised against the N terminal of NKAIN4

Purification: Affinity purified

Immunogen: NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKAIN4 Blocking Peptide, (ABIN5615002), is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKAIN4

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Alternative Name: NKAIN4

Background: The specific function of NKAIN4 is not yet known.

Molecular Weight: 23 kDa (MW of target protein)