CTRB1 antibody (N-Term)

Catalog No. ABIN636104

The Rabbit Polyclonal anti-CTRB1 antibody has been validated for WB. It is suitable to detect CTRB1 in samples from Human.

Quick Overview for CTRB1 antibody (N-Term) (ABIN636104)

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTRB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CTRB1 Antibody

Binding Specificity: N-Term

Specificity: Chymotrypsinogen B1 antibody was raised against the N terminal of CTRB1

Purification: Affinity purified

Immunogen: Chymotrypsinogen B1 antibody was raised using the N terminal of CTRB1 corresponding to a region with amino acids MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chymotrypsinogen B1 Blocking Peptide, (ABIN5612885), is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTRB1

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Alternative Name: Chymotrypsinogen B1

Background: Alpha-chymotrypsin is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Molecular Weight: 28 kDa (MW of target protein)